(data stored in ACNUC7421 zone)

EMBL: CP000489.PE545

CP000489.PE545       Location/Qualifiers
FT   CDS             complement(522559..523053)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0550"
FT                   /product="Lytic transglycosylase, catalytic"
FT                   /note="PFAM: Lytic transglycosylase, catalytic; KEGG:
FT                   sil:SPO2284 transglycosylase SLT domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68662"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZG8"
FT                   /protein_id="ABL68662.1"
FT                   /translation="MKSIIALLALGGVLAVGACGDNRVDPDRRYLVEPRASAAQVAALH
FT                   PNETPELRRLINKYAAEYEVPVDLVHRVIIRESTHRPGARNGPYYGLMQILPATARGMG
FT                   YRGSPAGLLDAETNLKYGVKYLRGAYMVADGNKDAAVKWYARGYYYEAKRKGLLEATGL
FT                   R"
     MKSIIALLAL GGVLAVGACG DNRVDPDRRY LVEPRASAAQ VAALHPNETP ELRRLINKYA        60
     AEYEVPVDLV HRVIIRESTH RPGARNGPYY GLMQILPATA RGMGYRGSPA GLLDAETNLK       120
     YGVKYLRGAY MVADGNKDAA VKWYARGYYY EAKRKGLLEA TGLR                        164
//

If you have problems or comments...

PBIL Back to PBIL home page