(data stored in ACNUC7421 zone)

EMBL: CP000489.PE546

CP000489.PE546       Location/Qualifiers
FT   CDS             complement(523200..524594)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0551"
FT                   /product="dihydrolipoamide dehydrogenase"
FT                   /EC_number="1.8.1.4"
FT                   /note="TIGRFAM: dihydrolipoamide dehydrogenase; PFAM:
FT                   FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; fumarate reductase/succinate dehydrogenase
FT                   flavoprotein domain protein; pyridine nucleotide-disulphide
FT                   oxidoreductase dimerisation region; HI0933 family protein;
FT                   FAD dependent oxidoreductase; KEGG: sil:SPO0340
FT                   2-oxoglutarate dehydrogenase, E3 component,
FT                   dihydrolipoamide dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68663"
FT                   /db_xref="GOA:A1AZG9"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR006258"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZG9"
FT                   /protein_id="ABL68663.1"
FT                   /translation="MSTYDLIVIGAGPGGYVCAIRAAQLGLKVACVEGRETLGGTCLNV
FT                   GCIPSKALLHASHMLHETHENFEKMGLMGAKPKVDWGKMQGYKAETVGGNTKGIEFLFK
FT                   KNKIDWLKGWASIEAPGKVKVGDTTHETKNIVIATGSEPASLKGVEVDNDAGIVVDSTG
FT                   ALSLPKIPKSMVVIGAGVIGLELGSAYARLGAEVTVVEFLDAITPGMDGEVQKQFQRIL
FT                   AKQGLKFVLGAAVSGVEVEKGKAEVKYKLRKDDSEHEIKAECVLVATGRRPYVAGLGLD
FT                   KVGVALTDRGFVQIDDHWQTSVKGIYAIGDAVPGPMLAHKAEDEGMAVAEVIAGKHGHV
FT                   NYDVIPGVIYTTPEVASVGLTEEAAKESGRKIKVGKFPFMGNARAKALFQAEGFVKMIA
FT                   DAETDRVLGCHIIGPNAGEMIHEVCVAMEFGASAQDIALTCHAHPTCSEAVREAALACG
FT                   DGAIHA"
     MSTYDLIVIG AGPGGYVCAI RAAQLGLKVA CVEGRETLGG TCLNVGCIPS KALLHASHML        60
     HETHENFEKM GLMGAKPKVD WGKMQGYKAE TVGGNTKGIE FLFKKNKIDW LKGWASIEAP       120
     GKVKVGDTTH ETKNIVIATG SEPASLKGVE VDNDAGIVVD STGALSLPKI PKSMVVIGAG       180
     VIGLELGSAY ARLGAEVTVV EFLDAITPGM DGEVQKQFQR ILAKQGLKFV LGAAVSGVEV       240
     EKGKAEVKYK LRKDDSEHEI KAECVLVATG RRPYVAGLGL DKVGVALTDR GFVQIDDHWQ       300
     TSVKGIYAIG DAVPGPMLAH KAEDEGMAVA EVIAGKHGHV NYDVIPGVIY TTPEVASVGL       360
     TEEAAKESGR KIKVGKFPFM GNARAKALFQ AEGFVKMIAD AETDRVLGCH IIGPNAGEMI       420
     HEVCVAMEFG ASAQDIALTC HAHPTCSEAV REAALACGDG AIHA                        464
//

If you have problems or comments...

PBIL Back to PBIL home page