(data stored in ACNUC7421 zone)

EMBL: CP000489.PE549

CP000489.PE549       Location/Qualifiers
FT   CDS             complement(525437..526969)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0554"
FT                   /product="2-oxoglutarate dehydrogenase E2 component"
FT                   /EC_number="2.3.1.61"
FT                   /note="TIGRFAM: 2-oxoglutarate dehydrogenase, E2 subunit,
FT                   dihydrolipoamide succinyltransferase; PFAM: biotin/lipoyl
FT                   attachment domain-containing protein; catalytic domain of
FT                   components of various dehydrogenase complexes; E3 binding
FT                   domain protein; KEGG: rsp:RSP_0964 dihydrolipoamide
FT                   acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68666"
FT                   /db_xref="GOA:A1AZH2"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001078"
FT                   /db_xref="InterPro:IPR004167"
FT                   /db_xref="InterPro:IPR006255"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR036625"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZH2"
FT                   /protein_id="ABL68666.1"
FT                   /translation="MAVELRVPTLGESVSEATVATWFKKPGDRVAVDEMLCELETDKVT
FT                   VEVPSPVAGKLAEIVAPEGAVVAPNALLAQIMEQGDAGPEEMLPKADAGTKAQEGQRNM
FT                   SGKSVDVMVPTLGESVTEATVATWFKKVGDSVAQDEMLCELETDKVSVEVPAPAAGVLA
FT                   EILAPEGATVDASAKLAIITEGAAGVAKAEAPAAAVQSPGAGPETPAPRKDVEDAPSAK
FT                   KAMAEAGVSRDAVTGTGRDGRVMKEDVARAASAPQAASPAPAPAQAPRAPSSADDAARE
FT                   ERVKMTRLRATIARRLKDAQNTAAMLTTYNEVDMKGIMDLRNTYKDQFEKKHKVKLGFM
FT                   SFFVKACCHALKEVPEVNAEIDGGDVVYKNFVHMGVAVGTPNGLVVPVVRDADQKSFAR
FT                   IEKEIAELGTRARDGKLTMAEMQGGTFTISNGGVYGSLMSSPILNPPQSGILGMHKIQD
FT                   RPVVVDGQIVIRPMMYLALSYDHRIVDGKGAVTFLVRVKEALEDPRRLLMDL"
     MAVELRVPTL GESVSEATVA TWFKKPGDRV AVDEMLCELE TDKVTVEVPS PVAGKLAEIV        60
     APEGAVVAPN ALLAQIMEQG DAGPEEMLPK ADAGTKAQEG QRNMSGKSVD VMVPTLGESV       120
     TEATVATWFK KVGDSVAQDE MLCELETDKV SVEVPAPAAG VLAEILAPEG ATVDASAKLA       180
     IITEGAAGVA KAEAPAAAVQ SPGAGPETPA PRKDVEDAPS AKKAMAEAGV SRDAVTGTGR       240
     DGRVMKEDVA RAASAPQAAS PAPAPAQAPR APSSADDAAR EERVKMTRLR ATIARRLKDA       300
     QNTAAMLTTY NEVDMKGIMD LRNTYKDQFE KKHKVKLGFM SFFVKACCHA LKEVPEVNAE       360
     IDGGDVVYKN FVHMGVAVGT PNGLVVPVVR DADQKSFARI EKEIAELGTR ARDGKLTMAE       420
     MQGGTFTISN GGVYGSLMSS PILNPPQSGI LGMHKIQDRP VVVDGQIVIR PMMYLALSYD       480
     HRIVDGKGAV TFLVRVKEAL EDPRRLLMDL                                        510
//

If you have problems or comments...

PBIL Back to PBIL home page