(data stored in ACNUC7421 zone)

EMBL: CP000489.PE55

CP000489.PE55        Location/Qualifiers
FT   CDS             complement(48379..48504)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0055"
FT                   /product="LSU ribosomal protein L36P"
FT                   /note="PFAM: ribosomal protein L36; KEGG: hne:HNE_3350
FT                   ribosomal protein L36"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68172"
FT                   /db_xref="GOA:A1AY28"
FT                   /db_xref="InterPro:IPR000473"
FT                   /db_xref="InterPro:IPR035977"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1AY28"
FT                   /protein_id="ABL68172.1"
FT                   /translation="MKVRNSLRSLKSRHRDCQVVRRKGRIYVINKTNPRFKARQG"
     MKVRNSLRSL KSRHRDCQVV RRKGRIYVIN KTNPRFKARQ G                            41
//

If you have problems or comments...

PBIL Back to PBIL home page