(data stored in ACNUC7421 zone)

EMBL: CP000489.PE554

CP000489.PE554       Location/Qualifiers
FT   CDS             complement(531478..532671)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0559"
FT                   /product="succinyl-CoA synthetase (ADP-forming) beta
FT                   subunit"
FT                   /EC_number="6.2.1.5"
FT                   /note="KEGG: rsp:RSP_0967 succinyl-CoA synthetase subunit
FT                   beta; TIGRFAM: succinyl-CoA synthetase, beta subunit; PFAM:
FT                   ATP-citrate lyase/succinyl-CoA ligase; ATP-grasp domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68671"
FT                   /db_xref="GOA:A1AZH7"
FT                   /db_xref="InterPro:IPR005809"
FT                   /db_xref="InterPro:IPR005811"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013650"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR017866"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1AZH7"
FT                   /protein_id="ABL68671.1"
FT                   /translation="MNIHEYQAKALLRQYGAPVSDGRVVMKADEAKAAAGELDGPLWVV
FT                   KAQIHAGGRGKGHFKEKEAGEKGGVRLAKSVEEAEELARQMLGRTLVTHQTGETGKQVN
FT                   RIYIEDGSDIERELYLALLVDRGTSRVSFVASTEGGMDIEEVAASTPEKIVSFSVDPAS
FT                   GLSDFHGRRVAFALGLSGAQVKQCVALVKNLYRMFIEKDMEMLEINPLIVMKDGNLKAL
FT                   DAKMGFDNNALYRQPDILALRDETEEDPKELAASKFDLNYIALDGEIGCMVNGAGLAMA
FT                   TMDIIKLFGAEPANFLDVGGGATKEKVTEAFKIITSDPNVKGILVNIFGGIMRCDIIAE
FT                   GIIAAVKEVGLQVPLVVRLEGTNVELGKQIIGESGLNVIAADDLSDAAQKIVKAVKG"
     MNIHEYQAKA LLRQYGAPVS DGRVVMKADE AKAAAGELDG PLWVVKAQIH AGGRGKGHFK        60
     EKEAGEKGGV RLAKSVEEAE ELARQMLGRT LVTHQTGETG KQVNRIYIED GSDIERELYL       120
     ALLVDRGTSR VSFVASTEGG MDIEEVAAST PEKIVSFSVD PASGLSDFHG RRVAFALGLS       180
     GAQVKQCVAL VKNLYRMFIE KDMEMLEINP LIVMKDGNLK ALDAKMGFDN NALYRQPDIL       240
     ALRDETEEDP KELAASKFDL NYIALDGEIG CMVNGAGLAM ATMDIIKLFG AEPANFLDVG       300
     GGATKEKVTE AFKIITSDPN VKGILVNIFG GIMRCDIIAE GIIAAVKEVG LQVPLVVRLE       360
     GTNVELGKQI IGESGLNVIA ADDLSDAAQK IVKAVKG                                397
//

If you have problems or comments...

PBIL Back to PBIL home page