(data stored in ACNUC7421 zone)

EMBL: CP000489.PE557

CP000489.PE557       Location/Qualifiers
FT   CDS             537341..538075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0562"
FT                   /product="protein of unknown function DUF81"
FT                   /note="PFAM: protein of unknown function DUF81; KEGG:
FT                   rsp:RSP_0969 putative integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68674"
FT                   /db_xref="GOA:A1AZI0"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZI0"
FT                   /protein_id="ABL68674.1"
FT                   /translation="MEMLGWVLAVIAAFSIGLAKGGLSMVGTISVPLLALVMSPVQAAG
FT                   ILLPVYIISDIGGLIAFRRDFDRRVLRTLVPGAITGIGLGWATAHHVDDAQVGLIVGVI
FT                   GLAFALNALLRSRVSASAKPPRWGAGSFWGTVSGYTSFVSHSGAAPYQVYAQPLRMTPM
FT                   TYAGTTTIFFAICNAVKLIPYAMLGQLSAHNLSVAAVLMVPGVLGVLAGLWLVRRMSPR
FT                   IFYGFITWALMLVSAQLIWDGI"
     MEMLGWVLAV IAAFSIGLAK GGLSMVGTIS VPLLALVMSP VQAAGILLPV YIISDIGGLI        60
     AFRRDFDRRV LRTLVPGAIT GIGLGWATAH HVDDAQVGLI VGVIGLAFAL NALLRSRVSA       120
     SAKPPRWGAG SFWGTVSGYT SFVSHSGAAP YQVYAQPLRM TPMTYAGTTT IFFAICNAVK       180
     LIPYAMLGQL SAHNLSVAAV LMVPGVLGVL AGLWLVRRMS PRIFYGFITW ALMLVSAQLI       240
     WDGI                                                                    244
//

If you have problems or comments...

PBIL Back to PBIL home page