(data stored in ACNUC7421 zone)

EMBL: CP000489.PE561

CP000489.PE561       Location/Qualifiers
FT   CDS             539810..540844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0566"
FT                   /product="L-erythro-3-methylmalyl-CoA dehydratase"
FT                   /EC_number="4.2.1.-"
FT                   /note="PFAM: MaoC domain protein dehydratase; KEGG:
FT                   sil:SPO0355 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68678"
FT                   /db_xref="GOA:A1AZI4"
FT                   /db_xref="InterPro:IPR002539"
FT                   /db_xref="InterPro:IPR016790"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZI4"
FT                   /protein_id="ABL68678.1"
FT                   /translation="MSKTNPGRFFEDYRIGQVIRHAVPRTVAEGERALYHALYPARHAL
FT                   YSSDEFAAASGLEGSPMDDLIAFHIVFGKTVPDISLNAVANLGYAEGRWLKPVWPGDTL
FT                   RAESEVIGLKENSNGKSGVVWVRTRGLNQLDEVVLEYVRWVMVRKGDAAAPAPEPVAPE
FT                   LAKSVAPADLVLPEGLDFLQYDFDLAGEPHRWGDYQIGEVIDHVDGVTIEEAEHMLATR
FT                   LWQNTAKVHFDATFREDGQRLIYGGHVISMARALSFNGLANAQMIVALNGGAHANPCFA
FT                   GDTIRAWSEVLDKADTHAPGVGAIRLRLVAHKGRAGDHALRGEDGKYAPQVLLDLDYWA
FT                   LMPK"
     MSKTNPGRFF EDYRIGQVIR HAVPRTVAEG ERALYHALYP ARHALYSSDE FAAASGLEGS        60
     PMDDLIAFHI VFGKTVPDIS LNAVANLGYA EGRWLKPVWP GDTLRAESEV IGLKENSNGK       120
     SGVVWVRTRG LNQLDEVVLE YVRWVMVRKG DAAAPAPEPV APELAKSVAP ADLVLPEGLD       180
     FLQYDFDLAG EPHRWGDYQI GEVIDHVDGV TIEEAEHMLA TRLWQNTAKV HFDATFREDG       240
     QRLIYGGHVI SMARALSFNG LANAQMIVAL NGGAHANPCF AGDTIRAWSE VLDKADTHAP       300
     GVGAIRLRLV AHKGRAGDHA LRGEDGKYAP QVLLDLDYWA LMPK                        344
//

If you have problems or comments...

PBIL Back to PBIL home page