(data stored in ACNUC7421 zone)

EMBL: CP000489.PE562

CP000489.PE562       Location/Qualifiers
FT   CDS             541157..541549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0567"
FT                   /product="succinate dehydrogenase subunit C"
FT                   /EC_number="1.3.5.1"
FT                   /note="PFAM: succinate dehydrogenase, cytochrome b subunit;
FT                   KEGG: rsp:RSP_0974 succinate dehydrogenase cytochrome b-556
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68679"
FT                   /db_xref="GOA:A1AZI5"
FT                   /db_xref="InterPro:IPR000701"
FT                   /db_xref="InterPro:IPR014314"
FT                   /db_xref="InterPro:IPR018495"
FT                   /db_xref="InterPro:IPR034804"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZI5"
FT                   /protein_id="ABL68679.1"
FT                   /translation="MADVNRGNRPLSPHLQVYRLPLAAITSIMTRITGHALVAGIVLIT
FT                   WWLVAAVTSPGAFACADWVVRSWLGFIILTGSMWALWYHLLAGLRHLFYDAGYGLEIEQ
FT                   AHKSSQALIAGSVVLAVLTLIVFFVF"
     MADVNRGNRP LSPHLQVYRL PLAAITSIMT RITGHALVAG IVLITWWLVA AVTSPGAFAC        60
     ADWVVRSWLG FIILTGSMWA LWYHLLAGLR HLFYDAGYGL EIEQAHKSSQ ALIAGSVVLA       120
     VLTLIVFFVF                                                              130
//

If you have problems or comments...

PBIL Back to PBIL home page