(data stored in ACNUC7421 zone)

EMBL: CP000489.PE565

CP000489.PE565       Location/Qualifiers
FT   CDS             543767..544123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0570"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: jan:Jann_0807 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68682"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZI8"
FT                   /protein_id="ABL68682.1"
FT                   /translation="MRLPLILTAAALALSGCVVQNPGMAPVAPLPVPQVTPPDAAIRSS
FT                   ARVVVNREMARRLPGANVAPYTDCVLQNATSAELASIAAAGAAGAGNAVAAIVGRPATT
FT                   QCIAGAAAAAKQAA"
     MRLPLILTAA ALALSGCVVQ NPGMAPVAPL PVPQVTPPDA AIRSSARVVV NREMARRLPG        60
     ANVAPYTDCV LQNATSAELA SIAAAGAAGA GNAVAAIVGR PATTQCIAGA AAAAKQAA         118
//

If you have problems or comments...

PBIL Back to PBIL home page