(data stored in ACNUC7421 zone)

EMBL: CP000489.PE566

CP000489.PE566       Location/Qualifiers
FT   CDS             544123..544449
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0571"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rsp:RSP_0978 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68683"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZI9"
FT                   /protein_id="ABL68683.1"
FT                   /translation="MAGRGALGLGFAPALLGLAACAPAPVRISVAEAERLCMVQALDAR
FT                   APRTEVGLGIGSHGYRGGFVRVDLSSDQILGRDPSQVFNECVRRRSGQQPTRPLYQQPG
FT                   WRVN"
     MAGRGALGLG FAPALLGLAA CAPAPVRISV AEAERLCMVQ ALDARAPRTE VGLGIGSHGY        60
     RGGFVRVDLS SDQILGRDPS QVFNECVRRR SGQQPTRPLY QQPGWRVN                    108
//

If you have problems or comments...

PBIL Back to PBIL home page