(data stored in ACNUC7421 zone)

EMBL: CP000489.PE572

CP000489.PE572       Location/Qualifiers
FT   CDS             549259..549783
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0577"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rsp:RSP_2271 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68689"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZJ5"
FT                   /protein_id="ABL68689.1"
FT                   /translation="MRNLAILAVLGLAACGENTGWNPNYSAMHNGSPYAEYLQAREVAL
FT                   HGKGPVPTAIPVQLPAQAPTAADIAGTPAKKQPAQAAAPAAPVRAQAVPPSLLRYAQQE
FT                   TQAPGTRKYQRSGGSESAAARACRSYGSADAAQSAFISAGGPVIDPGGLDPDGDGFVCG
FT                   WDPRPLRQSGL"
     MRNLAILAVL GLAACGENTG WNPNYSAMHN GSPYAEYLQA REVALHGKGP VPTAIPVQLP        60
     AQAPTAADIA GTPAKKQPAQ AAAPAAPVRA QAVPPSLLRY AQQETQAPGT RKYQRSGGSE       120
     SAAARACRSY GSADAAQSAF ISAGGPVIDP GGLDPDGDGF VCGWDPRPLR QSGL             174
//

If you have problems or comments...

PBIL Back to PBIL home page