(data stored in ACNUC7421 zone)

EMBL: CP000489.PE574

CP000489.PE574       Location/Qualifiers
FT   CDS             complement(550394..551167)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0579"
FT                   /product="protein of unknown function DUF519"
FT                   /note="PFAM: protein of unknown function DUF519; KEGG:
FT                   sil:SPO0421 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68691"
FT                   /db_xref="GOA:A1AZJ7"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR007473"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZJ7"
FT                   /protein_id="ABL68691.1"
FT                   /translation="MLSYQHAYHAGNLADLYKHALLASILAYLTAKPKPLSYLETHAGR
FT                   GLYDLSSPEADKTGEAAAGITRALAENWLPADHPLCLALDAVRARHGASAYPGSPLIAR
FT                   HFLRPGDVAHLAELHPAEHEALAEIAGFAHLHRQDGFQMAQAICPPTPRRGLLLIDPSY
FT                   EVKADYDAIPRQIAKLARKWNVGVIVLWYPILTDLRHAPMVEALRRNHPEALVSEVRFP
FT                   PARPGHGMVGSGMVVLNPPYGLAEEALRIEALYDR"
     MLSYQHAYHA GNLADLYKHA LLASILAYLT AKPKPLSYLE THAGRGLYDL SSPEADKTGE        60
     AAAGITRALA ENWLPADHPL CLALDAVRAR HGASAYPGSP LIARHFLRPG DVAHLAELHP       120
     AEHEALAEIA GFAHLHRQDG FQMAQAICPP TPRRGLLLID PSYEVKADYD AIPRQIAKLA       180
     RKWNVGVIVL WYPILTDLRH APMVEALRRN HPEALVSEVR FPPARPGHGM VGSGMVVLNP       240
     PYGLAEEALR IEALYDR                                                      257
//

If you have problems or comments...

PBIL Back to PBIL home page