(data stored in ACNUC7421 zone)

EMBL: CP000489.PE577

CP000489.PE577       Location/Qualifiers
FT   CDS             554021..554530
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0582"
FT                   /product="protein of unknown function UPF0040"
FT                   /note="PFAM: protein of unknown function UPF0040; KEGG:
FT                   rde:RD1_3370 MraZ protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68694"
FT                   /db_xref="GOA:A1AZK0"
FT                   /db_xref="InterPro:IPR003444"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR020603"
FT                   /db_xref="InterPro:IPR035642"
FT                   /db_xref="InterPro:IPR035644"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="InterPro:IPR038619"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZK0"
FT                   /protein_id="ABL68694.1"
FT                   /translation="MARRFRGSEEVKVDAKGRVSIPAKFRRVFEASDPDWQAGKRAQLV
FT                   IVYGTRDWNWLQLFTIQAMEEIEDGIAAMPRGSAARNLLENIYQGHADEAEIDGDGRLV
FT                   LPQKLREKIGLTDSAFFISAGDSLKVWTPEAYAEEERALEARVPELEPGADPLSLLAPA
FT                   TARDEG"
     MARRFRGSEE VKVDAKGRVS IPAKFRRVFE ASDPDWQAGK RAQLVIVYGT RDWNWLQLFT        60
     IQAMEEIEDG IAAMPRGSAA RNLLENIYQG HADEAEIDGD GRLVLPQKLR EKIGLTDSAF       120
     FISAGDSLKV WTPEAYAEEE RALEARVPEL EPGADPLSLL APATARDEG                   169
//

If you have problems or comments...

PBIL Back to PBIL home page