(data stored in ACNUC7421 zone)

EMBL: CP000489.PE579

CP000489.PE579       Location/Qualifiers
FT   CDS             555500..555883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0584"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sil:SPO1180 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68696"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZK2"
FT                   /protein_id="ABL68696.1"
FT                   /translation="MRSVLYLLTALSVMGLAFWAYRENYRTQAAISEMSDIQRQIGRLR
FT                   EDLGVLRAEWAYLNRPGRLRQLVDLNFERLKLVPFGSDQFVDVGQVAFPTPKAPEREPG
FT                   ADADMPVERPAGFPPRRPQESTP"
     MRSVLYLLTA LSVMGLAFWA YRENYRTQAA ISEMSDIQRQ IGRLREDLGV LRAEWAYLNR        60
     PGRLRQLVDL NFERLKLVPF GSDQFVDVGQ VAFPTPKAPE REPGADADMP VERPAGFPPR       120
     RPQESTP                                                                 127
//

If you have problems or comments...

PBIL Back to PBIL home page