(data stored in ACNUC7421 zone)

EMBL: CP000489.PE581

CP000489.PE581       Location/Qualifiers
FT   CDS             557715..559184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0586"
FT                   /product="UDP-N-acetylmuramoylalanyl-D-glutamate--2,
FT                   6-diaminopimelate ligase"
FT                   /EC_number="6.3.2.13"
FT                   /note="TIGRFAM: UDP-N-acetylmuramyl-tripeptide synthetases;
FT                   PFAM: cytoplasmic peptidoglycan synthetase domain protein;
FT                   cytoplasmic peptidoglycan synthetases domain protein; Mur
FT                   ligase, middle domain protein; KEGG: sil:SPO1182
FT                   UDP-N-acetylmuramoylalanyl-D-glutamate--2,
FT                   6-diaminopimelate ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68698"
FT                   /db_xref="GOA:A1AZK4"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005761"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR035911"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZK4"
FT                   /protein_id="ABL68698.1"
FT                   /translation="MRLSLLGLRGDKGRDPEVTGLAVDSRQVRPGHLFAALPGSATHGG
FT                   EFIQYALRQGAGAILTDRKGAEIAAAELVGADAALVVAEDPRAALAGAAALWFAAQPET
FT                   MVAVTGTSGKTSVASFTRQIWQALGHKAISLGTMGVQGDYQAKLAHTTPEPITLHRVLA
FT                   EAAAAGVTHAAMEASSHGLDQRRLDGVRLKAGAFTNFSQDHLDYHKDFDEYFAAKALLF
FT                   DHILEEGAGAVINIDDPRGRQMAQIAGERGLKLTTIGKDERADLRILGQRYDATGQDLR
FT                   FGFHGQAHLVRLALIGGFQAENVLAAAGLAIAAGDEAPRVIETLPGLTTVRGRMELAAV
FT                   RENGAAVFVDYSHKPGALASALQSLRPHVMGRIVVVFGAGGDRDRLKRPLMGEAARQFA
FT                   DVVYVTDDNPRSEDPAAIRAEVMAGAGPDAIEVGDRAEAILRGVDALQPGDALLIAGKG
FT                   HETGQIIGSDVYPFDDAEQASVAVAALDGKI"
     MRLSLLGLRG DKGRDPEVTG LAVDSRQVRP GHLFAALPGS ATHGGEFIQY ALRQGAGAIL        60
     TDRKGAEIAA AELVGADAAL VVAEDPRAAL AGAAALWFAA QPETMVAVTG TSGKTSVASF       120
     TRQIWQALGH KAISLGTMGV QGDYQAKLAH TTPEPITLHR VLAEAAAAGV THAAMEASSH       180
     GLDQRRLDGV RLKAGAFTNF SQDHLDYHKD FDEYFAAKAL LFDHILEEGA GAVINIDDPR       240
     GRQMAQIAGE RGLKLTTIGK DERADLRILG QRYDATGQDL RFGFHGQAHL VRLALIGGFQ       300
     AENVLAAAGL AIAAGDEAPR VIETLPGLTT VRGRMELAAV RENGAAVFVD YSHKPGALAS       360
     ALQSLRPHVM GRIVVVFGAG GDRDRLKRPL MGEAARQFAD VVYVTDDNPR SEDPAAIRAE       420
     VMAGAGPDAI EVGDRAEAIL RGVDALQPGD ALLIAGKGHE TGQIIGSDVY PFDDAEQASV       480
     AVAALDGKI                                                               489
//

If you have problems or comments...

PBIL Back to PBIL home page