(data stored in ACNUC7421 zone)

EMBL: CP000489.PE582

CP000489.PE582       Location/Qualifiers
FT   CDS             559181..560566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0587"
FT                   /product="UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine
FT                   ligase"
FT                   /EC_number="6.3.2.10"
FT                   /note="TIGRFAM: UDP-N-acetylmuramoylalanyl-D-glutamyl-2,
FT                   6-diaminopimelate--D-alanyl-D-alanyl ligase; PFAM:
FT                   cytoplasmic peptidoglycan synthetase domain protein;
FT                   cytoplasmic peptidoglycan synthetases domain protein; Mur
FT                   ligase, middle domain protein; KEGG: sil:SPO1183
FT                   UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68699"
FT                   /db_xref="GOA:A1AZK5"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005863"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR035911"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZK5"
FT                   /protein_id="ABL68699.1"
FT                   /translation="MTLWTSQDAAEATGGRATRDFAVGGVSIDTRTIRPGDLFVALQAA
FT                   RDGHDFVARALEKGACAALVSRIPEGVAPDAPLLVVPDVLPALEALGRAGRARMRGKVV
FT                   AITGSVGKTSTKEMARVALAGQGRVHAAEASYNNHWGVPLTLARMPEDTDFAIVEIGMN
FT                   HPGEIEPLARLARPHVAMVTTVAAAHLEAFGAIEGIAREKGAIFRGLIQPGTAIIPEDL
FT                   PVTQLLRDCADDAAAIVIGFGQQGMARPLKAETLDGVTRVRARVLGETVDFMLASAGTH
FT                   FVMNAVGMLAALSAAGADVAEAAKHLSDWRPPLGRGAVEDLDGIRLIDDAYNSNPTSLS
FT                   AGLATLARLTGGRRVAILGDMLELGPDEIALHAGMAGDPAMEAVDLVHTAGPRMRALHE
FT                   ALPQGRRGMHAETAAELAGKVGELVASGDIVLVKGSKSSKVSTVVDALRRTRQSTPPGE
FT                   RTA"
     MTLWTSQDAA EATGGRATRD FAVGGVSIDT RTIRPGDLFV ALQAARDGHD FVARALEKGA        60
     CAALVSRIPE GVAPDAPLLV VPDVLPALEA LGRAGRARMR GKVVAITGSV GKTSTKEMAR       120
     VALAGQGRVH AAEASYNNHW GVPLTLARMP EDTDFAIVEI GMNHPGEIEP LARLARPHVA       180
     MVTTVAAAHL EAFGAIEGIA REKGAIFRGL IQPGTAIIPE DLPVTQLLRD CADDAAAIVI       240
     GFGQQGMARP LKAETLDGVT RVRARVLGET VDFMLASAGT HFVMNAVGML AALSAAGADV       300
     AEAAKHLSDW RPPLGRGAVE DLDGIRLIDD AYNSNPTSLS AGLATLARLT GGRRVAILGD       360
     MLELGPDEIA LHAGMAGDPA MEAVDLVHTA GPRMRALHEA LPQGRRGMHA ETAAELAGKV       420
     GELVASGDIV LVKGSKSSKV STVVDALRRT RQSTPPGERT A                           461
//

If you have problems or comments...

PBIL Back to PBIL home page