(data stored in ACNUC7421 zone)

EMBL: CP000489.PE585

CP000489.PE585       Location/Qualifiers
FT   CDS             complement(563332..564489)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0590"
FT                   /product="membrane protein involved in aromatic hydrocarbon
FT                   degradation"
FT                   /note="PFAM: membrane protein involved in aromatic
FT                   hydrocarbon degradation; KEGG: rsp:RSP_0007 putative outer
FT                   membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68702"
FT                   /db_xref="InterPro:IPR005017"
FT                   /db_xref="InterPro:IPR042117"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZK8"
FT                   /protein_id="ABL68702.1"
FT                   /translation="MKRIITGIGALLATAAPVLAGGIERAPQSLAPLFEQGNYLELSFG
FT                   GVNPTVRGRDVAGVSTGDVAQGYGFFGLAYKHQFNENLSGALIVEQPFGADVLYPTANS
FT                   PVLGGTRVEVNSTTYTALLRYKFENNFSVHGGIRGSHADGNVRLQGAGYANSSGYNLDI
FT                   DGAWGVGWVAGVAYEMPEIAARVSLTYNSPIEHDFEMTESGGLLAATGQGTVRGEHTVK
FT                   TPRSWTLEGQTGIAADTLLFGSIRWVKWSEFKVENAHFPISPETFPGIVPPGTNIPLVE
FT                   LEDTTTYTIGVGRKFTDNWSGSVSFLYEPSEGNTVSPLAPVNGRKAVTVAAIYTMDNIK
FT                   ITTGINYTKLGDATLGVGQSGNKTEVARMDDGEAWAVAMRIGYSF"
     MKRIITGIGA LLATAAPVLA GGIERAPQSL APLFEQGNYL ELSFGGVNPT VRGRDVAGVS        60
     TGDVAQGYGF FGLAYKHQFN ENLSGALIVE QPFGADVLYP TANSPVLGGT RVEVNSTTYT       120
     ALLRYKFENN FSVHGGIRGS HADGNVRLQG AGYANSSGYN LDIDGAWGVG WVAGVAYEMP       180
     EIAARVSLTY NSPIEHDFEM TESGGLLAAT GQGTVRGEHT VKTPRSWTLE GQTGIAADTL       240
     LFGSIRWVKW SEFKVENAHF PISPETFPGI VPPGTNIPLV ELEDTTTYTI GVGRKFTDNW       300
     SGSVSFLYEP SEGNTVSPLA PVNGRKAVTV AAIYTMDNIK ITTGINYTKL GDATLGVGQS       360
     GNKTEVARMD DGEAWAVAMR IGYSF                                             385
//

If you have problems or comments...

PBIL Back to PBIL home page