(data stored in ACNUC7421 zone)

EMBL: CP000489.PE586

CP000489.PE586       Location/Qualifiers
FT   CDS             564656..565627
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0591"
FT                   /product="putative tellurite resistance protein"
FT                   /note="KEGG: rsp:RSP_2869 possible tellurite resistance
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68703"
FT                   /db_xref="GOA:A1AZK9"
FT                   /db_xref="InterPro:IPR004695"
FT                   /db_xref="InterPro:IPR038665"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZK9"
FT                   /protein_id="ABL68703.1"
FT                   /translation="MRFAPPRINPPGLWRRVPPAIFPPLLGALGLALAWRAATARFGLP
FT                   QGLSGMMMGMAVAAWVFATLAYGGKLARRPAVLAEELRILPGRAGIAAALVGIYVAAQL
FT                   LAPFAPALARVVLIAGMAAQAVFWAVAIPVMARTPGQGRVTPVWQLTFVGPIVAAQAAA
FT                   GFGWLGLAQALWWPMAAIAGFVWTVSLYQALTERLPAPLRPLLMIHLAPIAMLGNVAAA
FT                   LGWQDVALGLAWATAAALALAALRLRWLVEAGFSPLWGAFTFPLAATAGLWTAVSGFAS
FT                   GWSLPAQILLVAASLVVLPILFRVWRAWASGRLAMKTNAAIA"
     MRFAPPRINP PGLWRRVPPA IFPPLLGALG LALAWRAATA RFGLPQGLSG MMMGMAVAAW        60
     VFATLAYGGK LARRPAVLAE ELRILPGRAG IAAALVGIYV AAQLLAPFAP ALARVVLIAG       120
     MAAQAVFWAV AIPVMARTPG QGRVTPVWQL TFVGPIVAAQ AAAGFGWLGL AQALWWPMAA       180
     IAGFVWTVSL YQALTERLPA PLRPLLMIHL APIAMLGNVA AALGWQDVAL GLAWATAAAL       240
     ALAALRLRWL VEAGFSPLWG AFTFPLAATA GLWTAVSGFA SGWSLPAQIL LVAASLVVLP       300
     ILFRVWRAWA SGRLAMKTNA AIA                                               323
//

If you have problems or comments...

PBIL Back to PBIL home page