(data stored in ACNUC7421 zone)

EMBL: CP000489.PE587

CP000489.PE587       Location/Qualifiers
FT   CDS             565697..567145
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0592"
FT                   /product="inosine-5'-monophosphate dehydrogenase"
FT                   /EC_number="1.1.1.205"
FT                   /note="KEGG: rsp:RSP_2868 putative inosine-5'-monophosphate
FT                   dehydrogenase; TIGRFAM: inosine-5'-monophosphate
FT                   dehydrogenase; PFAM: CBS domain containing protein; IMP
FT                   dehydrogenase/GMP reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68704"
FT                   /db_xref="GOA:A1AZL0"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001093"
FT                   /db_xref="InterPro:IPR005990"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR015875"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZL0"
FT                   /protein_id="ABL68704.1"
FT                   /translation="MQIREALTFDDVLLVPAASSVMPSTADVTTYVTRQIRMNIPLLSS
FT                   AMDTVTESRMAIAMAQAGGIGVVHRNLTAEQQADEVRRVKRFESGIVYDPITLTPEQTI
FT                   ADAKALQERYNVTGFPVVDAAGRVVGIITNRDMRFANSDDMPVRAVMTSGNLAILREPA
FT                   DRAEAIDLMKARRIEKLLITNAEGKLTGLLTLKDTEKSVLNPLACKDELGRLRVAAAST
FT                   VGDEGYERSLALIEAGVDLVVIDTAHGHSEGVARAVSRIKAYSNQVQVVAGNVATADAA
FT                   RALVDAGADAIKVGIGPGSICTTRIVAGVGVPQLTAIMDAARGAGDVPVIADGGIKFSG
FT                   DFAKAIAAGASCAMVGSAIAGTDESPGEVILYQGRSFKSYRGMGSLGAMARGSADRYFQ
FT                   KDAASDKLVPEGIEGQVPYKGSAAAVIHQLVGGLRAAMGYTGNATVAEMRGGCEFVRIT
FT                   GAGLKESHVHDVQITRESPNYRLG"
     MQIREALTFD DVLLVPAASS VMPSTADVTT YVTRQIRMNI PLLSSAMDTV TESRMAIAMA        60
     QAGGIGVVHR NLTAEQQADE VRRVKRFESG IVYDPITLTP EQTIADAKAL QERYNVTGFP       120
     VVDAAGRVVG IITNRDMRFA NSDDMPVRAV MTSGNLAILR EPADRAEAID LMKARRIEKL       180
     LITNAEGKLT GLLTLKDTEK SVLNPLACKD ELGRLRVAAA STVGDEGYER SLALIEAGVD       240
     LVVIDTAHGH SEGVARAVSR IKAYSNQVQV VAGNVATADA ARALVDAGAD AIKVGIGPGS       300
     ICTTRIVAGV GVPQLTAIMD AARGAGDVPV IADGGIKFSG DFAKAIAAGA SCAMVGSAIA       360
     GTDESPGEVI LYQGRSFKSY RGMGSLGAMA RGSADRYFQK DAASDKLVPE GIEGQVPYKG       420
     SAAAVIHQLV GGLRAAMGYT GNATVAEMRG GCEFVRITGA GLKESHVHDV QITRESPNYR       480
     LG                                                                      482
//

If you have problems or comments...

PBIL Back to PBIL home page