(data stored in ACNUC7421 zone)

EMBL: CP000489.PE591

CP000489.PE591       Location/Qualifiers
FT   CDS             complement(571624..572208)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0596"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rsp:RSP_0453 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68708"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZL4"
FT                   /protein_id="ABL68708.1"
FT                   /translation="MLIFWERRLVFLATPKAGSTAVETALEALASVVVQRPAELKHADL
FT                   RTYRHHIEPWLRSVTGEKFTTIALMREPIGWLRSWYRFRLRDDDEDPNHAMIGLSFADF
FT                   AQAYADPGGPDVARVGAQADFLTAEVDRVDCIFRYEDMDAFTHFLEDRLDCEISLPRVN
FT                   VPPAVDVSLNPEQEGSLRKIMARDFALYASL"
     MLIFWERRLV FLATPKAGST AVETALEALA SVVVQRPAEL KHADLRTYRH HIEPWLRSVT        60
     GEKFTTIALM REPIGWLRSW YRFRLRDDDE DPNHAMIGLS FADFAQAYAD PGGPDVARVG       120
     AQADFLTAEV DRVDCIFRYE DMDAFTHFLE DRLDCEISLP RVNVPPAVDV SLNPEQEGSL       180
     RKIMARDFAL YASL                                                         194
//

If you have problems or comments...

PBIL Back to PBIL home page