(data stored in ACNUC7421 zone)

EMBL: CP000489.PE592

CP000489.PE592       Location/Qualifiers
FT   CDS             572452..573522
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0597"
FT                   /product="recA protein"
FT                   /note="KEGG: rsp:RSP_0452 recombinase A; TIGRFAM: recA
FT                   protein; PFAM: RecA domain protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68709"
FT                   /db_xref="GOA:A1AZL5"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013765"
FT                   /db_xref="InterPro:IPR020584"
FT                   /db_xref="InterPro:IPR020587"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR023400"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZL5"
FT                   /protein_id="ABL68709.1"
FT                   /translation="MAGATLFDMNDKRSADKQKALDSALAQIERQFGKGSIMKLGADNP
FT                   VAEIEATSTGSLGLDIALGIGGLPKGRIIEIFGPESSGKTTLTLHVVAEEQKKGGVCAF
FT                   VDAEHALDPQYAKKLGVNLDELLISQPDTGEQALEIVDTLVRSGAVSLVVVDSVAALTP
FT                   KSEIEGDMGDMQMGSQARLMSQAMRKLTASIGRSNCMVIFINQIRMKIGVMFGSPETTT
FT                   GGNALKFYASVRLDIRRAGSIKDRDEVTGNATRVKVVKNKVAPPFRQVEFDIMYGEGIS
FT                   KVGELIDLGIKAGVVEKSGSWYSYGDERIGQGRENAKQFLRDHPDMAHAIEDKIRASHG
FT                   LDFGVADDGDEVMAED"
     MAGATLFDMN DKRSADKQKA LDSALAQIER QFGKGSIMKL GADNPVAEIE ATSTGSLGLD        60
     IALGIGGLPK GRIIEIFGPE SSGKTTLTLH VVAEEQKKGG VCAFVDAEHA LDPQYAKKLG       120
     VNLDELLISQ PDTGEQALEI VDTLVRSGAV SLVVVDSVAA LTPKSEIEGD MGDMQMGSQA       180
     RLMSQAMRKL TASIGRSNCM VIFINQIRMK IGVMFGSPET TTGGNALKFY ASVRLDIRRA       240
     GSIKDRDEVT GNATRVKVVK NKVAPPFRQV EFDIMYGEGI SKVGELIDLG IKAGVVEKSG       300
     SWYSYGDERI GQGRENAKQF LRDHPDMAHA IEDKIRASHG LDFGVADDGD EVMAED           356
//

If you have problems or comments...

PBIL Back to PBIL home page