(data stored in ACNUC7421 zone)

EMBL: CP000489.PE594

CP000489.PE594       Location/Qualifiers
FT   CDS             576403..576693
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0599"
FT                   /product="protein of unknown function DUF1330"
FT                   /note="PFAM: protein of unknown function DUF1330; KEGG:
FT                   rsp:RSP_0450 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0599"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68711"
FT                   /db_xref="InterPro:IPR010753"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZL7"
FT                   /protein_id="ABL68711.1"
FT                   /translation="MTALWIAHVNVTDPEAYGEYARLAGPAIAAHGGAFLARGSRYVQL
FT                   EGKDRARNVVARFPSLEDAVACYRSAEYQAALEHAKGAAERDLVIVEENPA"
     MTALWIAHVN VTDPEAYGEY ARLAGPAIAA HGGAFLARGS RYVQLEGKDR ARNVVARFPS        60
     LEDAVACYRS AEYQAALEHA KGAAERDLVI VEENPA                                  96
//

If you have problems or comments...

PBIL Back to PBIL home page