(data stored in ACNUC7421 zone)

EMBL: CP000489.PE596

CP000489.PE596       Location/Qualifiers
FT   CDS             complement(577694..577939)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0601"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0601"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68713"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZL9"
FT                   /protein_id="ABL68713.1"
FT                   /translation="MCAHALAGRRNGRRRIDDKAVLDCADRFPRRWCLALHDGLFGSRW
FT                   PASIPAMPCWISMGKGLGEIRDFLIRESRRVLSIPI"
     MCAHALAGRR NGRRRIDDKA VLDCADRFPR RWCLALHDGL FGSRWPASIP AMPCWISMGK        60
     GLGEIRDFLI RESRRVLSIP I                                                  81
//

If you have problems or comments...

PBIL Back to PBIL home page