(data stored in ACNUC7421 zone)

EMBL: CP000489.PE603

CP000489.PE603       Location/Qualifiers
FT   CDS             complement(582803..584503)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0608"
FT                   /product="extracellular solute-binding protein, family 5"
FT                   /note="PFAM: extracellular solute-binding protein, family
FT                   5; KEGG: sil:SPO2814 peptide/opine/nickel uptake family ABC
FT                   transporter, periplasmic substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0608"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68720"
FT                   /db_xref="GOA:A1AZM6"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZM6"
FT                   /protein_id="ABL68720.1"
FT                   /translation="MKLKTLMLGAAATAAMAPAAFAERGSDGQVNVIMWQAPSTMNPYL
FT                   SAGTKDIIAGSVVLEPLASFTPEGEVVPRLAAEIPSVENGGISEDLKTVTWKLQPDIKW
FT                   SDGTPFTAEDVAFTAEYCMSPNGGCAQLAKFEGVEKVEAVDELTVRVTFVSPRPDPFSA
FT                   FVGAQSPILQKAQFQNCLGEAAPTCTQQNFNPVGTGAFVVKEFRTNDVISFAANPEYRD
FT                   PAKPAFATLLMKGGGDSAAAARAVLETGEFDYAWNTQLAPDVIAGMEAAGKGKNVAAFG
FT                   SLVERIHVNLTDPSPGLPEGERSTVKHPHPILTDPAVRKALSMAIDRELLTEIGYGPAG
FT                   QPTCNLVPAPAAWASENTECFTQDIEGAKALLDEAGWTVGAGGVREKDGKRLTLLFQTS
FT                   VNAVRQDFQALIKQWWSEIGVETELKVVDPSVFFGGDAGSPDTFQKLYADVEMYANNFE
FT                   GSNPEPYLARQTCDKAPGPENQWQGENTSRYCDPEYDRLIAEMTQIVDPAERGAMGRRL
FT                   NEMLTKDSNAIIPLVYRGTTSAHANSLGGVALNAWDSELWNVADWHRVK"
     MKLKTLMLGA AATAAMAPAA FAERGSDGQV NVIMWQAPST MNPYLSAGTK DIIAGSVVLE        60
     PLASFTPEGE VVPRLAAEIP SVENGGISED LKTVTWKLQP DIKWSDGTPF TAEDVAFTAE       120
     YCMSPNGGCA QLAKFEGVEK VEAVDELTVR VTFVSPRPDP FSAFVGAQSP ILQKAQFQNC       180
     LGEAAPTCTQ QNFNPVGTGA FVVKEFRTND VISFAANPEY RDPAKPAFAT LLMKGGGDSA       240
     AAARAVLETG EFDYAWNTQL APDVIAGMEA AGKGKNVAAF GSLVERIHVN LTDPSPGLPE       300
     GERSTVKHPH PILTDPAVRK ALSMAIDREL LTEIGYGPAG QPTCNLVPAP AAWASENTEC       360
     FTQDIEGAKA LLDEAGWTVG AGGVREKDGK RLTLLFQTSV NAVRQDFQAL IKQWWSEIGV       420
     ETELKVVDPS VFFGGDAGSP DTFQKLYADV EMYANNFEGS NPEPYLARQT CDKAPGPENQ       480
     WQGENTSRYC DPEYDRLIAE MTQIVDPAER GAMGRRLNEM LTKDSNAIIP LVYRGTTSAH       540
     ANSLGGVALN AWDSELWNVA DWHRVK                                            566
//

If you have problems or comments...

PBIL Back to PBIL home page