(data stored in ACNUC7421 zone)

EMBL: CP000489.PE604

CP000489.PE604       Location/Qualifiers
FT   CDS             584724..586553
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0609"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related;
FT                   Oligopeptide/dipeptide ABC transporter, C-terminal domain
FT                   protein; SMART: AAA ATPase; KEGG: sil:SPO2813
FT                   peptide/nickel/opine uptake family ABC transporter,
FT                   ATP-binding protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0609"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68721"
FT                   /db_xref="GOA:A1AZM7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZM7"
FT                   /protein_id="ABL68721.1"
FT                   /translation="MLDTKPLVRIEGLRVEFQTHDGPVTGVEDLSFDIRPGECLCVVGE
FT                   SGSGKSVSSLSLMRLVEFGGGEIANGRLLFQRERDEIDLAKAPPAAMRDIRGNEIAMIF
FT                   QEPMTALNPVFTVGEQLAEGLIVHRGLTRAQARARAPELLHEVRIPEPERRLRQYPHEL
FT                   SGGMRQRVVIAMAMACRPRLLICDEPTTALDVTIQAEILTLIDRLKRETGMAVLFITHD
FT                   MAVVAQMADRVVVMFRGNKVEEGPVGQIFEAPREPYTQALLAAVPRLGEMTGRDAPEPM
FT                   RLMREGQVARPEPVIPPAPAPLLVVRNLCTRFAVKGGILRRTVAQVHAVEDVSFTVNAG
FT                   ETLSLVGESGCGKSTTGRSILRLVEPSSGQVSLGGRDILALGASDLRKARRDMQMIFQD
FT                   PFASLDPQMRLLDQIEEPMLNYGIGNRVERRDRIARLFDRVELPRGFMKRYPHELSGGQ
FT                   RQRIAIARALALNPKLIIADEAVSALDVSVQAQVLNLLMELQRDLGISMLFISHDMAVV
FT                   ERVSHHVGVMYLGRIVEIGTRRQVFENPQHGYTRQLMAAVPVADPRRRKIGEDLRFRPI
FT                   PSPIHPVGHVPAPSVYREVAPGHLVLAEPATHG"
     MLDTKPLVRI EGLRVEFQTH DGPVTGVEDL SFDIRPGECL CVVGESGSGK SVSSLSLMRL        60
     VEFGGGEIAN GRLLFQRERD EIDLAKAPPA AMRDIRGNEI AMIFQEPMTA LNPVFTVGEQ       120
     LAEGLIVHRG LTRAQARARA PELLHEVRIP EPERRLRQYP HELSGGMRQR VVIAMAMACR       180
     PRLLICDEPT TALDVTIQAE ILTLIDRLKR ETGMAVLFIT HDMAVVAQMA DRVVVMFRGN       240
     KVEEGPVGQI FEAPREPYTQ ALLAAVPRLG EMTGRDAPEP MRLMREGQVA RPEPVIPPAP       300
     APLLVVRNLC TRFAVKGGIL RRTVAQVHAV EDVSFTVNAG ETLSLVGESG CGKSTTGRSI       360
     LRLVEPSSGQ VSLGGRDILA LGASDLRKAR RDMQMIFQDP FASLDPQMRL LDQIEEPMLN       420
     YGIGNRVERR DRIARLFDRV ELPRGFMKRY PHELSGGQRQ RIAIARALAL NPKLIIADEA       480
     VSALDVSVQA QVLNLLMELQ RDLGISMLFI SHDMAVVERV SHHVGVMYLG RIVEIGTRRQ       540
     VFENPQHGYT RQLMAAVPVA DPRRRKIGED LRFRPIPSPI HPVGHVPAPS VYREVAPGHL       600
     VLAEPATHG                                                               609
//

If you have problems or comments...

PBIL Back to PBIL home page