(data stored in ACNUC7421 zone)

EMBL: CP000489.PE605

CP000489.PE605       Location/Qualifiers
FT   CDS             586652..587821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0610"
FT                   /product="amidohydrolase"
FT                   /EC_number="3.5.1.32"
FT                   /note="KEGG: sit:TM1040_0719 peptidase M20D,
FT                   amidohydrolase; TIGRFAM: amidohydrolase; PFAM: peptidase
FT                   M20; peptidase dimerisation domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0610"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68722"
FT                   /db_xref="GOA:A1AZM8"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017439"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZM8"
FT                   /protein_id="ABL68722.1"
FT                   /translation="MPVKNRFAELLPEITAWRRDFHENPELDYQVHRTAGRVAELLRGF
FT                   GVDEVNEGVGRTGVVGVIRGRSNSSGRVIGLRADMDALPINEQTGAEYASKNPGVMHAC
FT                   GHDGHTAMLLGAAKYLAETRNFDGTAVVIFQPAEEGGAGGLAMVQDGLVDRWGIQEFYG
FT                   MHNMPGYPTGSFAIREGAMMAAADQFDIVVTGKGGHAAKPHEAIDTTLVAAQIIVALQS
FT                   IVARNVDPLKSGVISVCVVQTDSTAHNVIPQVVKLKGTARSLAPEVRDQLEEGIKRVAT
FT                   HTAAAFGAAAEVTYDRGYPVTMNHPEATGFAAEVARQVAGEVNMEMEPLMAGEDFSYML
FT                   NERPGAYIFVGNGDTAMVHHPAYDFDDNAIPAGSSWYAGMVEARMPILA"
     MPVKNRFAEL LPEITAWRRD FHENPELDYQ VHRTAGRVAE LLRGFGVDEV NEGVGRTGVV        60
     GVIRGRSNSS GRVIGLRADM DALPINEQTG AEYASKNPGV MHACGHDGHT AMLLGAAKYL       120
     AETRNFDGTA VVIFQPAEEG GAGGLAMVQD GLVDRWGIQE FYGMHNMPGY PTGSFAIREG       180
     AMMAAADQFD IVVTGKGGHA AKPHEAIDTT LVAAQIIVAL QSIVARNVDP LKSGVISVCV       240
     VQTDSTAHNV IPQVVKLKGT ARSLAPEVRD QLEEGIKRVA THTAAAFGAA AEVTYDRGYP       300
     VTMNHPEATG FAAEVARQVA GEVNMEMEPL MAGEDFSYML NERPGAYIFV GNGDTAMVHH       360
     PAYDFDDNAI PAGSSWYAGM VEARMPILA                                         389
//

If you have problems or comments...

PBIL Back to PBIL home page