(data stored in ACNUC7421 zone)

EMBL: CP000489.PE606

CP000489.PE606       Location/Qualifiers
FT   CDS             complement(587908..589299)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0611"
FT                   /product="dihydrolipoamide dehydrogenase"
FT                   /EC_number="1.8.1.4"
FT                   /note="TIGRFAM: dihydrolipoamide dehydrogenase; PFAM:
FT                   FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; glucose-inhibited division protein A;
FT                   pyridine nucleotide-disulphide oxidoreductase dimerisation
FT                   region; FAD dependent oxidoreductase; KEGG: rsp:RSP_2968
FT                   dihydrolipoamide dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0611"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68723"
FT                   /db_xref="GOA:A1AZM9"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR006258"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZM9"
FT                   /protein_id="ABL68723.1"
FT                   /translation="MAQSFDMVVIGSGPGGYVCAIRGAQLGLKVACIEREHLGGICLNW
FT                   GCIPTKALLRSAEVFHLMHRAKEFGLSADKIGYDLGAVVQRSRGVAKQLAGGVGHLLKK
FT                   NKVTVIMGEASLTAPGKISVKTDKGTEEVTGKAIVLATGARARELPGLEPDGDLVWNYK
FT                   HALQPPRMPKKLLVIGSGAIGIEFASFFNTLGADTTVVEVMDRVLPVEDAEISALAKKQ
FT                   FVKQGMKILEKAAVKKLDRAKGKVTAHIETGGKTETHEFDTVISAVGIVGNVENLGLEK
FT                   LGAKIDRTHVVTDEYCRTGVEGLYAIGDVAGAPWLAHKASHEGVMVAELIAGGHPHPIK
FT                   PNSIPGCTYCNPQVASVGLTEEKAKAAGYEVKVGRFPFIGNGKAIALGEPEGLIKTVFD
FT                   AKTGELLGAHMVGAEVTELIQGYVVGRTLETTEAELMETVFPHPTLSEMLHEATLSAYG
FT                   RAIHF"
     MAQSFDMVVI GSGPGGYVCA IRGAQLGLKV ACIEREHLGG ICLNWGCIPT KALLRSAEVF        60
     HLMHRAKEFG LSADKIGYDL GAVVQRSRGV AKQLAGGVGH LLKKNKVTVI MGEASLTAPG       120
     KISVKTDKGT EEVTGKAIVL ATGARARELP GLEPDGDLVW NYKHALQPPR MPKKLLVIGS       180
     GAIGIEFASF FNTLGADTTV VEVMDRVLPV EDAEISALAK KQFVKQGMKI LEKAAVKKLD       240
     RAKGKVTAHI ETGGKTETHE FDTVISAVGI VGNVENLGLE KLGAKIDRTH VVTDEYCRTG       300
     VEGLYAIGDV AGAPWLAHKA SHEGVMVAEL IAGGHPHPIK PNSIPGCTYC NPQVASVGLT       360
     EEKAKAAGYE VKVGRFPFIG NGKAIALGEP EGLIKTVFDA KTGELLGAHM VGAEVTELIQ       420
     GYVVGRTLET TEAELMETVF PHPTLSEMLH EATLSAYGRA IHF                         463
//

If you have problems or comments...

PBIL Back to PBIL home page