(data stored in ACNUC7421 zone)

EMBL: CP000489.PE607

CP000489.PE607       Location/Qualifiers
FT   CDS             complement(589345..589926)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0612"
FT                   /product="protein of unknown function DUF924"
FT                   /note="PFAM: protein of unknown function DUF924; KEGG:
FT                   sil:SPO2224 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0612"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68724"
FT                   /db_xref="InterPro:IPR010323"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZN0"
FT                   /protein_id="ABL68724.1"
FT                   /translation="MTDTVTPEGINRFWLDEVGEEGWYARSDDLDETIRQRFQPAWARA
FT                   ADLVPGWATTPEGALAGLILTDQFPRNMFREDARAFDTDPLARSLAREAIANGFHLRIE
FT                   PPGRQFFYLPFEHSEDLADQERAVSLFAEFMPGENLRHAELHRDAIARFGRFPWRNAAL
FT                   NRVPTAAESRVMEAGGYGALVSGKLSLADV"
     MTDTVTPEGI NRFWLDEVGE EGWYARSDDL DETIRQRFQP AWARAADLVP GWATTPEGAL        60
     AGLILTDQFP RNMFREDARA FDTDPLARSL AREAIANGFH LRIEPPGRQF FYLPFEHSED       120
     LADQERAVSL FAEFMPGENL RHAELHRDAI ARFGRFPWRN AALNRVPTAA ESRVMEAGGY       180
     GALVSGKLSL ADV                                                          193
//

If you have problems or comments...

PBIL Back to PBIL home page