(data stored in ACNUC7421 zone)

EMBL: CP000489.PE613

CP000489.PE613       Location/Qualifiers
FT   CDS             593973..595313
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0618"
FT                   /product="UDP-N-acetylglucosamine pyrophosphorylase"
FT                   /EC_number="2.7.7.23"
FT                   /note="PFAM: 4-diphosphocytidyl-2C-methyl-D-erythritol
FT                   synthase; transferase hexapeptide repeat containing
FT                   protein; Nucleotidyl transferase; KEGG: rsp:RSP_2503
FT                   glucosamine-1-phosphate N-acetyltransferase;
FT                   UDP-N-acetylglucosamine pyrophosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0618"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68730"
FT                   /db_xref="GOA:A1AZN6"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005882"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR038009"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1AZN6"
FT                   /protein_id="ABL68730.1"
FT                   /translation="MTEKPVALIVLAAGQGSRMQSDLPKVLHRLGGVPLVGHALSTGRT
FT                   LEPEAVVVVAGHGAEAVAKAVAKLNPEAKIALQEQQLGTGHAVSQALPQLEGFEGRVIV
FT                   LYGDTPFIGQETLASLAAHPADVVVLGFEASDPGRYGRLVTGPEGLERIVEYKDADEAT
FT                   RAIRLVNSGVLAADAALLREFLPMIGNRNAAGEYYLTDIPELARAAGHRVEVVTCDEAE
FT                   TLGINTRAELAAAEAAFQVRARARALEDGVTMTDPATVWFALDTCIGRDAVIGQNVVFG
FT                   PGVTVESGAEILPFCHLEGCHVSAGATVGPFARLRPGAELGGDVHVGNFVEIKNSVLDE
FT                   GAKVGHLTYLGDAHVGEATNIGAGTVTCNYDGVSKHRTEIGAHAFIGSDTMLVAPVRVG
FT                   ARAMTGSGSVITEDVPDDALALGRAKQVVKPGLATRLMQALRQKKGN"
     MTEKPVALIV LAAGQGSRMQ SDLPKVLHRL GGVPLVGHAL STGRTLEPEA VVVVAGHGAE        60
     AVAKAVAKLN PEAKIALQEQ QLGTGHAVSQ ALPQLEGFEG RVIVLYGDTP FIGQETLASL       120
     AAHPADVVVL GFEASDPGRY GRLVTGPEGL ERIVEYKDAD EATRAIRLVN SGVLAADAAL       180
     LREFLPMIGN RNAAGEYYLT DIPELARAAG HRVEVVTCDE AETLGINTRA ELAAAEAAFQ       240
     VRARARALED GVTMTDPATV WFALDTCIGR DAVIGQNVVF GPGVTVESGA EILPFCHLEG       300
     CHVSAGATVG PFARLRPGAE LGGDVHVGNF VEIKNSVLDE GAKVGHLTYL GDAHVGEATN       360
     IGAGTVTCNY DGVSKHRTEI GAHAFIGSDT MLVAPVRVGA RAMTGSGSVI TEDVPDDALA       420
     LGRAKQVVKP GLATRLMQAL RQKKGN                                            446
//

If you have problems or comments...

PBIL Back to PBIL home page