(data stored in ACNUC7421 zone)

EMBL: CP000489.PE616

CP000489.PE616       Location/Qualifiers
FT   CDS             598259..598843
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0621"
FT                   /product="peptide methionine sulfoxide reductase"
FT                   /EC_number="1.8.4.11"
FT                   /note="KEGG: rpa:RPA4834 peptide methionine sulfoxide
FT                   reductase; TIGRFAM: peptide methionine sulfoxide reductase;
FT                   PFAM: Methionine sulfoxide reductase A"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0621"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68733"
FT                   /db_xref="GOA:A1AZN9"
FT                   /db_xref="InterPro:IPR002569"
FT                   /db_xref="InterPro:IPR036509"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZN9"
FT                   /protein_id="ABL68733.1"
FT                   /translation="MNAPIHRIFGRPLDAEMPKGYDQAIFGMGCYWGVERLFWQQEGVW
FT                   LTEVGFAGGTTENPSYKQVCAGGTGHAEVVHVVYDSSRVSYERLLQIFWENHDPTQGNR
FT                   QGNDVGSQYRSLIMVFNDSQKAAAELSKADYGNRLAVQGYPDITTQILPAGPFWRAEDD
FT                   HQQYLDRYPDGYCGLRGTGVKAPLTDIAEGY"
     MNAPIHRIFG RPLDAEMPKG YDQAIFGMGC YWGVERLFWQ QEGVWLTEVG FAGGTTENPS        60
     YKQVCAGGTG HAEVVHVVYD SSRVSYERLL QIFWENHDPT QGNRQGNDVG SQYRSLIMVF       120
     NDSQKAAAEL SKADYGNRLA VQGYPDITTQ ILPAGPFWRA EDDHQQYLDR YPDGYCGLRG       180
     TGVKAPLTDI AEGY                                                         194
//

If you have problems or comments...

PBIL Back to PBIL home page