(data stored in ACNUC7421 zone)

EMBL: CP000489.PE625

CP000489.PE625       Location/Qualifiers
FT   CDS             complement(606107..607291)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0630"
FT                   /product="aromatic amino acid aminotransferase apoenzyme"
FT                   /EC_number="2.6.1.57"
FT                   /note="PFAM: aminotransferase, class I and II; KEGG:
FT                   rde:RD1_0935 aromatic amino acid aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0630"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68742"
FT                   /db_xref="GOA:A1AZP8"
FT                   /db_xref="InterPro:IPR000796"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZP8"
FT                   /protein_id="ABL68742.1"
FT                   /translation="MLGNLKPQAPDKILALMGEFRADPRQGKIDLGVGVYKDATGHTPI
FT                   MRAVHAAEQRMLETETTKTYAGLSGEPEFQKAMGELILGDGLKSETTATLATVGGTGAL
FT                   RQALELARMANPDLRVFVSDPTWPNHVSIMNFMGLPVQTYRYFDAETRGVDFEGMKADL
FT                   AAAKKGDMVLLHGCCHNPTGANLTLDQWAEIASILEKTGALPLIDLAYQGFGDGLEEDA
FT                   AGTRLIASRIPEVLIAASCSKNFGIYRERTGCLLALCADAATRELAQGAMAFLNRQTYS
FT                   FPPFHGAKIVSTVLTTPELRADWMAELEAVRSGMLRLREQLAGELRDLSGSDRFGFVAE
FT                   HRGMFSRLGATPEQVKRIKEEFGIYMVGDSRINIAGLNDNTIPILARAIIEVGV"
     MLGNLKPQAP DKILALMGEF RADPRQGKID LGVGVYKDAT GHTPIMRAVH AAEQRMLETE        60
     TTKTYAGLSG EPEFQKAMGE LILGDGLKSE TTATLATVGG TGALRQALEL ARMANPDLRV       120
     FVSDPTWPNH VSIMNFMGLP VQTYRYFDAE TRGVDFEGMK ADLAAAKKGD MVLLHGCCHN       180
     PTGANLTLDQ WAEIASILEK TGALPLIDLA YQGFGDGLEE DAAGTRLIAS RIPEVLIAAS       240
     CSKNFGIYRE RTGCLLALCA DAATRELAQG AMAFLNRQTY SFPPFHGAKI VSTVLTTPEL       300
     RADWMAELEA VRSGMLRLRE QLAGELRDLS GSDRFGFVAE HRGMFSRLGA TPEQVKRIKE       360
     EFGIYMVGDS RINIAGLNDN TIPILARAII EVGV                                   394
//

If you have problems or comments...

PBIL Back to PBIL home page