(data stored in ACNUC7421 zone)

EMBL: CP000489.PE626

CP000489.PE626       Location/Qualifiers
FT   CDS             complement(607291..608151)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0631"
FT                   /product="3-mercaptopyruvate sulfurtransferase"
FT                   /EC_number="2.8.1.2"
FT                   /note="PFAM: Rhodanese domain protein; KEGG: rsp:RSP_0885
FT                   thiosulfate sulfurtransferase, rhodanese-like"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0631"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68743"
FT                   /db_xref="GOA:A1AZP9"
FT                   /db_xref="InterPro:IPR001307"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZP9"
FT                   /protein_id="ABL68743.1"
FT                   /translation="MSTDSDDPKVLVSTDWLAAHLSDPDLRVIDATWFLEPGRDARAEY
FT                   MAAHIPGARFFDIDEIADKRSELPHMAPQPEMFISRMRAMGIGDGHQVVIYDNSPVRSA
FT                   ARVWWTFKLMGKQDVAVLDGGFGKWLAEGREIEDMPPILRDRHITVQRQAALVRDVTQV
FT                   AAASKLGDHEIVDARSAERFRGEATEPRAGLRSGHIPGSKSLPFGRLYDQDGTLKSPDA
FT                   LRAEFEAAGVDLSKPVITTCGSGVTAAVLFLALERIGHRDHSLYDGSWAEWGSFPDLKI
FT                   ATGDA"
     MSTDSDDPKV LVSTDWLAAH LSDPDLRVID ATWFLEPGRD ARAEYMAAHI PGARFFDIDE        60
     IADKRSELPH MAPQPEMFIS RMRAMGIGDG HQVVIYDNSP VRSAARVWWT FKLMGKQDVA       120
     VLDGGFGKWL AEGREIEDMP PILRDRHITV QRQAALVRDV TQVAAASKLG DHEIVDARSA       180
     ERFRGEATEP RAGLRSGHIP GSKSLPFGRL YDQDGTLKSP DALRAEFEAA GVDLSKPVIT       240
     TCGSGVTAAV LFLALERIGH RDHSLYDGSW AEWGSFPDLK IATGDA                      286
//

If you have problems or comments...

PBIL Back to PBIL home page