(data stored in ACNUC7421 zone)

EMBL: CP000489.PE632

CP000489.PE632       Location/Qualifiers
FT   CDS             complement(612897..614948)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0637"
FT                   /product="penicillin-binding protein 1C"
FT                   /note="TIGRFAM: penicillin-binding protein 1C; PFAM:
FT                   glycosyl transferase, family 51; penicillin-binding
FT                   protein, transpeptidase; Penicillin-binding domain protein;
FT                   KEGG: sil:SPO0135 penicillin-binding protein 1C"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0637"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68749"
FT                   /db_xref="GOA:A1AZQ5"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR009647"
FT                   /db_xref="InterPro:IPR011815"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZQ5"
FT                   /protein_id="ABL68749.1"
FT                   /translation="MRSRRFALSLMAAVLVLGIGAGARDRFDDWVDATALPRLEVPVGA
FT                   EVVARDGTLLRAFQVADGRWRLDAGPVDPLFLDMLLLWEDRRFPGHSGIDARALLRAGV
FT                   QALRHGRVVSGGSTLTMQAARLIEDGPTGQWAGKGRQMRLALALERRLGKREIMELYLR
FT                   LAPYGANVEGIRAASLQWFGKEPRRLTPAQAALLVALPQSPETRRPDRFPERATAARDR
FT                   VLARAARAGLISDADARAAMAEPVPRVRRAFPALAPLLAARLVREHPGALRIETTIDAR
FT                   LQRRAEELASRAVRGAGRRLSAAVVLADHRNGEILAEVGAADWTDGASAGFVDMARAWR
FT                   SPGSTLKPFVYGLAFDDGLAHPETLIEDRPTVFGRWQPQNFDHHFRGTVSLKNALIWSL
FT                   NIPVVKLADAVGPNRVTQALRRGGVELRLPGEVPGLAVVLGGAGVTLEGLAEGYAALAR
FT                   GGRGITLSALPGGGEERPAPMFGPVAAWQVGNILGQNPAPQGVRQRVLAYKTGTSYGHR
FT                   DALAVGFDGARVGAVWLGRPDGTPVPGAFGGDLAAPVLFDLFDALPSVALPPPPPQTLT
FT                   LPNSALPLPLRRFAPAGTASAMAARPAGPDALRLTYPPDGAEIDARGPLTAKARGGRGP
FT                   WTFLLNGAPAAIAQPQPLASLPNPGPGFAELTVVDADGASATAAIRLH"
     MRSRRFALSL MAAVLVLGIG AGARDRFDDW VDATALPRLE VPVGAEVVAR DGTLLRAFQV        60
     ADGRWRLDAG PVDPLFLDML LLWEDRRFPG HSGIDARALL RAGVQALRHG RVVSGGSTLT       120
     MQAARLIEDG PTGQWAGKGR QMRLALALER RLGKREIMEL YLRLAPYGAN VEGIRAASLQ       180
     WFGKEPRRLT PAQAALLVAL PQSPETRRPD RFPERATAAR DRVLARAARA GLISDADARA       240
     AMAEPVPRVR RAFPALAPLL AARLVREHPG ALRIETTIDA RLQRRAEELA SRAVRGAGRR       300
     LSAAVVLADH RNGEILAEVG AADWTDGASA GFVDMARAWR SPGSTLKPFV YGLAFDDGLA       360
     HPETLIEDRP TVFGRWQPQN FDHHFRGTVS LKNALIWSLN IPVVKLADAV GPNRVTQALR       420
     RGGVELRLPG EVPGLAVVLG GAGVTLEGLA EGYAALARGG RGITLSALPG GGEERPAPMF       480
     GPVAAWQVGN ILGQNPAPQG VRQRVLAYKT GTSYGHRDAL AVGFDGARVG AVWLGRPDGT       540
     PVPGAFGGDL AAPVLFDLFD ALPSVALPPP PPQTLTLPNS ALPLPLRRFA PAGTASAMAA       600
     RPAGPDALRL TYPPDGAEID ARGPLTAKAR GGRGPWTFLL NGAPAAIAQP QPLASLPNPG       660
     PGFAELTVVD ADGASATAAI RLH                                               683
//

If you have problems or comments...

PBIL Back to PBIL home page