(data stored in ACNUC7421 zone)

EMBL: CP000489.PE65

CP000489.PE65        Location/Qualifiers
FT   CDS             57925..58224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0065"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68182"
FT                   /db_xref="GOA:A1AY38"
FT                   /db_xref="UniProtKB/TrEMBL:A1AY38"
FT                   /protein_id="ABL68182.1"
FT                   /translation="MVWFGALVDCWAGGVACWVCSEFPILFQLLIILCHFFEFCLLRVP
FT                   GGRPKYPLTETTGRSERDGTRRWKVRFWRQSGNERPDGASLEWRNFRVFLSSAF"
     MVWFGALVDC WAGGVACWVC SEFPILFQLL IILCHFFEFC LLRVPGGRPK YPLTETTGRS        60
     ERDGTRRWKV RFWRQSGNER PDGASLEWRN FRVFLSSAF                               99
//

If you have problems or comments...

PBIL Back to PBIL home page