(data stored in ACNUC7421 zone)

EMBL: CP000489.PE66

CP000489.PE66        Location/Qualifiers
FT   CDS             complement(64006..64503)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0066"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bhe:BH15450 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68183"
FT                   /db_xref="InterPro:IPR041635"
FT                   /db_xref="UniProtKB/TrEMBL:A1AY39"
FT                   /protein_id="ABL68183.1"
FT                   /translation="MPRIPRVKAADDFWAFSKAGRVLAALHVNYEQVEPYPVTFIRGDT
FT                   SLVPPPDPERFYRVEQMKFAGKRPKLDRSTVIYNASITISGIPLEAYDYVVNGKPALEW
FT                   VMERQCVKTDKASGIVNDANRYAIETVGDPVYPLRLFQRIITVSLETMKIVKALPALGD
FT                   LS"
     MPRIPRVKAA DDFWAFSKAG RVLAALHVNY EQVEPYPVTF IRGDTSLVPP PDPERFYRVE        60
     QMKFAGKRPK LDRSTVIYNA SITISGIPLE AYDYVVNGKP ALEWVMERQC VKTDKASGIV       120
     NDANRYAIET VGDPVYPLRL FQRIITVSLE TMKIVKALPA LGDLS                       165
//

If you have problems or comments...

PBIL Back to PBIL home page