(data stored in ACNUC7421 zone)

EMBL: CP000489.PE67

CP000489.PE67        Location/Qualifiers
FT   CDS             64712..65059
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0067"
FT                   /product="IS66 Orf2 family protein"
FT                   /note="PFAM: IS66 Orf2 family protein; KEGG: sme:SMa1613
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68184"
FT                   /db_xref="InterPro:IPR008878"
FT                   /db_xref="UniProtKB/TrEMBL:A1AY40"
FT                   /protein_id="ABL68184.1"
FT                   /translation="MIGPGTGVRVYLACGVTDMRKGISGLAALAQDVLRQKPAGGAVFA
FT                   FRGRRGDRLKLLHWDGQGFCLYYKVLEKGRFPWPMRGDGAVRLTSAQLAMLWEGIDWRR
FT                   PDWGAPPARVG"
     MIGPGTGVRV YLACGVTDMR KGISGLAALA QDVLRQKPAG GAVFAFRGRR GDRLKLLHWD        60
     GQGFCLYYKV LEKGRFPWPM RGDGAVRLTS AQLAMLWEGI DWRRPDWGAP PARVG            115
//

If you have problems or comments...

PBIL Back to PBIL home page