(data stored in ACNUC7421 zone)

EMBL: CP000489.PE68

CP000489.PE68        Location/Qualifiers
FT   CDS             65122..66750
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0068"
FT                   /product="transposase IS66"
FT                   /note="PFAM: transposase IS66; KEGG: sme:SMa2171
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68185"
FT                   /db_xref="InterPro:IPR004291"
FT                   /db_xref="InterPro:IPR024463"
FT                   /db_xref="InterPro:IPR024474"
FT                   /db_xref="InterPro:IPR039552"
FT                   /db_xref="UniProtKB/TrEMBL:A1AY41"
FT                   /protein_id="ABL68185.1"
FT                   /translation="MSNAAQTLPDDPALLKSLIAALQAENAKISATLRAHDQLIQSLRL
FT                   RIARLKKQVFGQSSEKIEREIEQLELALEDLMIAAAEGQPDVVNDGQNDDGLETAPADE
FT                   AAERPSRRRPRVSDSTPRERRELDPGSCCPDCGGDLRLVGEDVSEMLDLIAAQLKVVQI
FT                   ARLKKSCRRCERMVQMPAPSRPIPGSMAGANLLAHILVSKFDDHLPLYRQHEIFTRMGA
FT                   DIPDSTLVDWCGRAMKVLAPLIERIEVDVMASDLLHADDTPIRVLDRAGRDKGVGKGVK
FT                   KGRIWAYVRDQRPWAGASPPGAVYAFAPDWKEEHVHGHLANTRGILQADGYKGYAKLYE
FT                   PEPDGKPRLREAACWAHLRRDFHDEWTKTKSTIAREALDRIGALYDIEREITGHPADIR
FT                   LAARRKHSVPKVEVFFAWSEQQLSRIPGKGDLAKAFRYGLSRRDAFSLFLEDGRVAIDN
FT                   NPAERALRPIGVGRRNWLFAGADTGAETLARAMTIVETAKMNGLDPQAYLADILARIHD
FT                   HKINRLDDLLPWNWSPLPSALHEAA"
     MSNAAQTLPD DPALLKSLIA ALQAENAKIS ATLRAHDQLI QSLRLRIARL KKQVFGQSSE        60
     KIEREIEQLE LALEDLMIAA AEGQPDVVND GQNDDGLETA PADEAAERPS RRRPRVSDST       120
     PRERRELDPG SCCPDCGGDL RLVGEDVSEM LDLIAAQLKV VQIARLKKSC RRCERMVQMP       180
     APSRPIPGSM AGANLLAHIL VSKFDDHLPL YRQHEIFTRM GADIPDSTLV DWCGRAMKVL       240
     APLIERIEVD VMASDLLHAD DTPIRVLDRA GRDKGVGKGV KKGRIWAYVR DQRPWAGASP       300
     PGAVYAFAPD WKEEHVHGHL ANTRGILQAD GYKGYAKLYE PEPDGKPRLR EAACWAHLRR       360
     DFHDEWTKTK STIAREALDR IGALYDIERE ITGHPADIRL AARRKHSVPK VEVFFAWSEQ       420
     QLSRIPGKGD LAKAFRYGLS RRDAFSLFLE DGRVAIDNNP AERALRPIGV GRRNWLFAGA       480
     DTGAETLARA MTIVETAKMN GLDPQAYLAD ILARIHDHKI NRLDDLLPWN WSPLPSALHE       540
     AA                                                                      542
//

If you have problems or comments...

PBIL Back to PBIL home page