(data stored in ACNUC7421 zone)

EMBL: CP000489.PE69

CP000489.PE69        Location/Qualifiers
FT   CDS             66750..67046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0069"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sme:SMa1608 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68186"
FT                   /db_xref="UniProtKB/TrEMBL:A1AY42"
FT                   /protein_id="ABL68186.1"
FT                   /translation="MATVTHVCTLDYIAKMLGEDPELLKAIVYNDDNLTYGSIISVYTG
FT                   PDDTVTALTDDGIDELKDMLRDARITTETWHAFLDDFVDDAELVARIKAQSPR"
     MATVTHVCTL DYIAKMLGED PELLKAIVYN DDNLTYGSII SVYTGPDDTV TALTDDGIDE        60
     LKDMLRDARI TTETWHAFLD DFVDDAELVA RIKAQSPR                                98
//

If you have problems or comments...

PBIL Back to PBIL home page