(data stored in ACNUC7421 zone)

EMBL: CP000489.PE71

CP000489.PE71        Location/Qualifiers
FT   CDS             67303..67578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0071"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68188"
FT                   /db_xref="UniProtKB/TrEMBL:A1AY44"
FT                   /protein_id="ABL68188.1"
FT                   /translation="MTHSSSQFDDGQRSRRRWPQQEKLQRPCSDRCQDRPGRVRCTRSG
FT                   QAGPLPVCHAAKHMTSRRHESGIMIWPRNPRTTVRRTPLCVSPARH"
     MTHSSSQFDD GQRSRRRWPQ QEKLQRPCSD RCQDRPGRVR CTRSGQAGPL PVCHAAKHMT        60
     SRRHESGIMI WPRNPRTTVR RTPLCVSPAR H                                       91
//

If you have problems or comments...

PBIL Back to PBIL home page