(data stored in ACNUC7421 zone)

EMBL: CP000489.PE74

CP000489.PE74        Location/Qualifiers
FT   CDS             69942..70397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0074"
FT                   /product="adenylate cyclase"
FT                   /note="PFAM: adenylate cyclase; KEGG: neu:NE1496
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68191"
FT                   /db_xref="InterPro:IPR012042"
FT                   /db_xref="InterPro:IPR023577"
FT                   /db_xref="InterPro:IPR033469"
FT                   /db_xref="UniProtKB/TrEMBL:A1AY47"
FT                   /protein_id="ABL68191.1"
FT                   /translation="MKEIERKFLVEGPVPKGLYARPILQGYLTAATDSVEIRLRREGDD
FT                   YSLTLKSDGGLTREEREIALGAAEFEALWPATEGRCVEKTRHRGTLPGGQAFELDVFSG
FT                   HLAPLMLVEVEFPSEEAALAFAPPAWFGQEVTEDKRFKNKALALSRP"
     MKEIERKFLV EGPVPKGLYA RPILQGYLTA ATDSVEIRLR REGDDYSLTL KSDGGLTREE        60
     REIALGAAEF EALWPATEGR CVEKTRHRGT LPGGQAFELD VFSGHLAPLM LVEVEFPSEE       120
     AALAFAPPAW FGQEVTEDKR FKNKALALSR P                                      151
//

If you have problems or comments...

PBIL Back to PBIL home page