(data stored in ACNUC7421 zone)

EMBL: CP000489.PE76

CP000489.PE76        Location/Qualifiers
FT   CDS             complement(70813..71199)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0076"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68193"
FT                   /db_xref="GOA:A1AY49"
FT                   /db_xref="UniProtKB/TrEMBL:A1AY49"
FT                   /protein_id="ABL68193.1"
FT                   /translation="MNPFCQHALVAPGDRHVNRRDSEDYSGSQIGHCINRAKRKRPASS
FT                   ANQRDCSPFSSSDDDQPSAYLVVFLFLVSGWAIMIIALTATACWILDMSLMSIIYGYLG
FT                   GGVFGAMVAIIGSLLVHETRHDAG"
     MNPFCQHALV APGDRHVNRR DSEDYSGSQI GHCINRAKRK RPASSANQRD CSPFSSSDDD        60
     QPSAYLVVFL FLVSGWAIMI IALTATACWI LDMSLMSIIY GYLGGGVFGA MVAIIGSLLV       120
     HETRHDAG                                                                128
//

If you have problems or comments...

PBIL Back to PBIL home page