(data stored in ACNUC7421 zone)

EMBL: CP000489.PE79

CP000489.PE79        Location/Qualifiers
FT   CDS             72151..72867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0079"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; KEGG: nar:Saro_0441 two component
FT                   transcriptional regulator, winged helix family"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68196"
FT                   /db_xref="GOA:A1AY52"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A1AY52"
FT                   /protein_id="ABL68196.1"
FT                   /translation="MTGEQKGIRVLLVEDEETVLQLHGAVLVGAGCVVDEAPTLACFRD
FT                   RIARSRYDIVLLDLCLPDGNALEAISEIRRGTSAGIIVATSNRDPDDRLTGLEQGADEY
FT                   LEKPVHPRELVARVRNLAGRLAVAKREEKMELVHHFQGWSVDLAARTVRLHDGDTLQLT
FT                   ENEFRLLDVLIRNAAKPVHRERLLTALGSDEEATDRAVDKAIYRLRVKLHAVLGHATPL
FT                   IETVHGFGYRFIAEIL"
     MTGEQKGIRV LLVEDEETVL QLHGAVLVGA GCVVDEAPTL ACFRDRIARS RYDIVLLDLC        60
     LPDGNALEAI SEIRRGTSAG IIVATSNRDP DDRLTGLEQG ADEYLEKPVH PRELVARVRN       120
     LAGRLAVAKR EEKMELVHHF QGWSVDLAAR TVRLHDGDTL QLTENEFRLL DVLIRNAAKP       180
     VHRERLLTAL GSDEEATDRA VDKAIYRLRV KLHAVLGHAT PLIETVHGFG YRFIAEIL         238
//

If you have problems or comments...

PBIL Back to PBIL home page