(data stored in ACNUC7421 zone)

EMBL: CP000489.PE8

CP000489.PE8         Location/Qualifiers
FT   CDS             complement(7526..8065)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0008"
FT                   /product="GrpE protein"
FT                   /note="PFAM: GrpE protein; KEGG: rsp:RSP_1219 putative
FT                   chaperone protein GrpE (heat shock protein)"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68125"
FT                   /db_xref="GOA:A1AXY1"
FT                   /db_xref="InterPro:IPR000740"
FT                   /db_xref="InterPro:IPR009012"
FT                   /db_xref="InterPro:IPR013805"
FT                   /db_xref="UniProtKB/TrEMBL:A1AXY1"
FT                   /protein_id="ABL68125.1"
FT                   /translation="MTNENPNGSPLDEEIIDPPADEVPSPEVEALIAERDEYRDRFMRA
FT                   LADAENARKRAEKDRRDAEQYGGSRLARDLLPVHDALTRALEAASEDQRAAAALIEGVE
FT                   LTLRELNNVFAKHGIKVITPAPGEKFDPQQHEAMFEAPVPGTVAGSIIQVMDNGFMLHD
FT                   RLLRPAKVGVSSTPAS"
     MTNENPNGSP LDEEIIDPPA DEVPSPEVEA LIAERDEYRD RFMRALADAE NARKRAEKDR        60
     RDAEQYGGSR LARDLLPVHD ALTRALEAAS EDQRAAAALI EGVELTLREL NNVFAKHGIK       120
     VITPAPGEKF DPQQHEAMFE APVPGTVAGS IIQVMDNGFM LHDRLLRPAK VGVSSTPAS        179
//

If you have problems or comments...

PBIL Back to PBIL home page