(data stored in ACNUC7421 zone)

EMBL: CP000489.PE80

CP000489.PE80        Location/Qualifiers
FT   CDS             72869..75208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0080"
FT                   /product="PAS/PAC sensor hybrid histidine kinase"
FT                   /note="TIGRFAM: PAS sensor protein; PFAM: response
FT                   regulator receiver; ATP-binding region, ATPase domain
FT                   protein domain protein; histidine kinase A domain protein
FT                   domain protein; KEGG: ccr:CC0026 sensory box histidine
FT                   kinase/response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68197"
FT                   /db_xref="GOA:A1AY53"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A1AY53"
FT                   /protein_id="ABL68197.1"
FT                   /translation="MAGVPPDSRRAAMADEAESMTTFAVLRPDGLISYCSAPFAHLLGS
FT                   EERVVVGTPIGAWLRPVEGAGSGWFAVVRQSEGHLLRTGGVGQFRYRLDPMAGGGAVLH
FT                   LMQGTGNLDPIYARAFQLNPGLSALSVLDTGEHLDVNDAWLRNMEYRREEVIGRTASEM
FT                   QVWEQGDTSRTEIVRRLREDGKIENFQARMRTRTGKLRDILVSAELVEHAGRKLAFFAS
FT                   HDITEVKKAQEELEALNRQLEQRIAERTAEIVRKNRELAEAAERAQAANEAKSQFLSVM
FT                   SHEIRTPLNALLNMAELLIEDGNPAPAAAHLSGIASSARALAAIVDDVLDFSRIESGHL
FT                   EIYPAATDIGRLCEEAVRGVAPLAHRKGLDIVLTFGQRLPATAMVDPLRLRQILFNLVG
FT                   NAIKYTRKGWIEVRADVTGETAEPQLLVEVIDTGIGIRPNDLERIFERFSRIGADANHE
FT                   IHGAGLGLNISAGLARAMGGTIRVESEVDRGSAFRVTLPLVTCGELAEDPLRQPLQGRV
FT                   ALLGPATRTRSTFEAILKRQGVVAQRVLSASGAQVITMESGRSAIDCAMRQSFDILLLD
FT                   LRMPDLSGYETAVRIRALGGWAADVPIVAVSANIAPDKAQMQAAGIDGFLAKPFTPTAL
FT                   RAKVQGHLHHSAGDTEPDDSIRADATPVLDESFLAAQVTYAGPDAVGKAIAGFLGNLDG
FT                   RLSRIWSGADARERADAAHMLAGAAGALGLLDLATHCRRLASDRGDSPTASLRQDRDIL
FT                   ASSAGRAVAALREVRDKLAAGSSRQD"
     MAGVPPDSRR AAMADEAESM TTFAVLRPDG LISYCSAPFA HLLGSEERVV VGTPIGAWLR        60
     PVEGAGSGWF AVVRQSEGHL LRTGGVGQFR YRLDPMAGGG AVLHLMQGTG NLDPIYARAF       120
     QLNPGLSALS VLDTGEHLDV NDAWLRNMEY RREEVIGRTA SEMQVWEQGD TSRTEIVRRL       180
     REDGKIENFQ ARMRTRTGKL RDILVSAELV EHAGRKLAFF ASHDITEVKK AQEELEALNR       240
     QLEQRIAERT AEIVRKNREL AEAAERAQAA NEAKSQFLSV MSHEIRTPLN ALLNMAELLI       300
     EDGNPAPAAA HLSGIASSAR ALAAIVDDVL DFSRIESGHL EIYPAATDIG RLCEEAVRGV       360
     APLAHRKGLD IVLTFGQRLP ATAMVDPLRL RQILFNLVGN AIKYTRKGWI EVRADVTGET       420
     AEPQLLVEVI DTGIGIRPND LERIFERFSR IGADANHEIH GAGLGLNISA GLARAMGGTI       480
     RVESEVDRGS AFRVTLPLVT CGELAEDPLR QPLQGRVALL GPATRTRSTF EAILKRQGVV       540
     AQRVLSASGA QVITMESGRS AIDCAMRQSF DILLLDLRMP DLSGYETAVR IRALGGWAAD       600
     VPIVAVSANI APDKAQMQAA GIDGFLAKPF TPTALRAKVQ GHLHHSAGDT EPDDSIRADA       660
     TPVLDESFLA AQVTYAGPDA VGKAIAGFLG NLDGRLSRIW SGADARERAD AAHMLAGAAG       720
     ALGLLDLATH CRRLASDRGD SPTASLRQDR DILASSAGRA VAALREVRDK LAAGSSRQD        779
//

If you have problems or comments...

PBIL Back to PBIL home page