(data stored in ACNUC7421 zone)

EMBL: CP000489.PE81

CP000489.PE81        Location/Qualifiers
FT   CDS             75555..77324
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0081"
FT                   /product="regulatory protein, LuxR"
FT                   /note="PFAM: regulatory protein, LuxR; KEGG: sil:SPO1388
FT                   transcriptional regulator, LuxR family/hydrolase,
FT                   alpha/beta fold family"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68198"
FT                   /db_xref="GOA:A1AY54"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A1AY54"
FT                   /protein_id="ABL68198.1"
FT                   /translation="MLESKPKTPLADQHFFLSPQLSEGQSSDDDIDLNIIASTYRSIID
FT                   EHAFDEMVASWETKLASSGGDAEHPKVSKGLFSQLLTFRNTLEKLDVPTESDPLKLAVS
FT                   EVPGPATVLSPNGNVAVINIAGERAFGTRQGAFMDVAVIAPNSLEDYCALLRAATGQGN
FT                   AAQAILTILPATEGYGESFLAEGYLIRVPGQSGAHIAIRSLEIAWGPRIAEQLQQAFGL
FT                   TQAESEVAHLFFRLRNLESIAAERGVSLLTVRTQIKTIMAKMGAPSNIDLMRLLAMIAS
FT                   REHVGLRGEAPVWHDPLGREKLIEMPDGRKIAWTWIGAKRGAPVVMLRGLPMTYLLPGG
FT                   GEARLRDAGICLYVPSRPGHGNSTMDSSLDVMSDNLVALRVFLDQVIGRPCLGVGLASG
FT                   TLPLVVEAVANPARFHGILAVGFSCGIDPSGVQRLPQIQRIMLQLADSAPWVAELMAKS
FT                   GHRMMRQHGLDWYLERAFRHTPLNQQTVRNPDWTALIRNACEHLLKQGHATFVRELQLS
FT                   RHRMDTALRELRIPMRYLAPTEDPGIDLASCRQLERINPLITVEPVTDAAELVFYQRND
FT                   LILDRIIALVHRN"
     MLESKPKTPL ADQHFFLSPQ LSEGQSSDDD IDLNIIASTY RSIIDEHAFD EMVASWETKL        60
     ASSGGDAEHP KVSKGLFSQL LTFRNTLEKL DVPTESDPLK LAVSEVPGPA TVLSPNGNVA       120
     VINIAGERAF GTRQGAFMDV AVIAPNSLED YCALLRAATG QGNAAQAILT ILPATEGYGE       180
     SFLAEGYLIR VPGQSGAHIA IRSLEIAWGP RIAEQLQQAF GLTQAESEVA HLFFRLRNLE       240
     SIAAERGVSL LTVRTQIKTI MAKMGAPSNI DLMRLLAMIA SREHVGLRGE APVWHDPLGR       300
     EKLIEMPDGR KIAWTWIGAK RGAPVVMLRG LPMTYLLPGG GEARLRDAGI CLYVPSRPGH       360
     GNSTMDSSLD VMSDNLVALR VFLDQVIGRP CLGVGLASGT LPLVVEAVAN PARFHGILAV       420
     GFSCGIDPSG VQRLPQIQRI MLQLADSAPW VAELMAKSGH RMMRQHGLDW YLERAFRHTP       480
     LNQQTVRNPD WTALIRNACE HLLKQGHATF VRELQLSRHR MDTALRELRI PMRYLAPTED       540
     PGIDLASCRQ LERINPLITV EPVTDAAELV FYQRNDLILD RIIALVHRN                   589
//

If you have problems or comments...

PBIL Back to PBIL home page