(data stored in ACNUC7421 zone)

EMBL: CP000489.PE83

CP000489.PE83        Location/Qualifiers
FT   CDS             complement(77791..78135)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0083"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68200"
FT                   /db_xref="UniProtKB/TrEMBL:A1AY56"
FT                   /protein_id="ABL68200.1"
FT                   /translation="MIRQAPLRGSDPKLSAWLHEQDRLASLVSETETPARTRRHTREAH
FT                   HLGLNTKRLEQVIQRPFQFMVLTEEIHPGLANSSEVPGNVPHFLPAERVETRLGRMHCK
FT                   PHSLPMNKVI"
     MIRQAPLRGS DPKLSAWLHE QDRLASLVSE TETPARTRRH TREAHHLGLN TKRLEQVIQR        60
     PFQFMVLTEE IHPGLANSSE VPGNVPHFLP AERVETRLGR MHCKPHSLPM NKVI             114
//

If you have problems or comments...

PBIL Back to PBIL home page