(data stored in ACNUC7421 zone)

EMBL: CP000489.PE84

CP000489.PE84        Location/Qualifiers
FT   CDS             78314..78568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0084"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rso:RSc2496 hypothetical signal peptide
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68201"
FT                   /db_xref="InterPro:IPR018660"
FT                   /db_xref="InterPro:IPR036328"
FT                   /db_xref="UniProtKB/TrEMBL:A1AY57"
FT                   /protein_id="ABL68201.1"
FT                   /translation="MKAGANSFAPMEIDREERSFVNAVSGSGARYVSGELVWWTKGNNA
FT                   TLESALDGAARRNASRDLAIPTRGRAVRSGPGQPGAFPI"
     MKAGANSFAP MEIDREERSF VNAVSGSGAR YVSGELVWWT KGNNATLESA LDGAARRNAS        60
     RDLAIPTRGR AVRSGPGQPG AFPI                                               84
//

If you have problems or comments...

PBIL Back to PBIL home page