(data stored in ACNUC7421 zone)

EMBL: CP000489.PE86

CP000489.PE86        Location/Qualifiers
FT   CDS             79239..79514
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0086"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68203"
FT                   /db_xref="UniProtKB/TrEMBL:A1AY59"
FT                   /protein_id="ABL68203.1"
FT                   /translation="MQRHPEDQIGRKDFLPNLLSQDFKTDVPLQSASFPAAGGAASPSA
FT                   MMPCPIRFRLAQHRDGRRAAFRSGAAGISPPGRTVAPLLGRSPAHR"
     MQRHPEDQIG RKDFLPNLLS QDFKTDVPLQ SASFPAAGGA ASPSAMMPCP IRFRLAQHRD        60
     GRRAAFRSGA AGISPPGRTV APLLGRSPAH R                                       91
//

If you have problems or comments...

PBIL Back to PBIL home page