(data stored in ACNUC7421 zone)

EMBL: CP000489.PE9

CP000489.PE9         Location/Qualifiers
FT   CDS             complement(8073..9128)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0009"
FT                   /product="heat-inducible transcription repressor HrcA"
FT                   /note="TIGRFAM: heat-inducible transcription repressor
FT                   HrcA; PFAM: Negative regulator of class I heat shock
FT                   protein; KEGG: sit:TM1040_2873 heat-inducible transcription
FT                   repressor HrcA"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68126"
FT                   /db_xref="GOA:A1AXY2"
FT                   /db_xref="InterPro:IPR002571"
FT                   /db_xref="InterPro:IPR021153"
FT                   /db_xref="InterPro:IPR023120"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1AXY2"
FT                   /protein_id="ABL68126.1"
FT                   /translation="MLETALLSDLNDRSREVFRRVVEAYLATGEPVGSRTLTREMSEKL
FT                   SAATIRNVMQDLELLGLLDHPHISAGRMPTQLGLRLFVDGLMEAGPVSSSDREMIEETL
FT                   GDDNRDTGVMLDRVSTALSALTRGASLVLMPKQEAPVRHIEFVSLAPDRSLVVLVFADG
FT                   RVENRVFTPPPGHTASSMREAANFLNAVAEGRTLAELRRSVAHEIEASRQKLDSVAAQL
FT                   VSSGLAQWEGESSDPRLIVRGRANLLAHELADLDRIRTLFDDLERKRDIAEFLELAEQG
FT                   EGVRIFIGSENKLFSLSGSSLVVSPYMNADRKIVGAVGVIGPTRLNYGRIVPIVDYTAQ
FT                   LVGRLISGRKG"
     MLETALLSDL NDRSREVFRR VVEAYLATGE PVGSRTLTRE MSEKLSAATI RNVMQDLELL        60
     GLLDHPHISA GRMPTQLGLR LFVDGLMEAG PVSSSDREMI EETLGDDNRD TGVMLDRVST       120
     ALSALTRGAS LVLMPKQEAP VRHIEFVSLA PDRSLVVLVF ADGRVENRVF TPPPGHTASS       180
     MREAANFLNA VAEGRTLAEL RRSVAHEIEA SRQKLDSVAA QLVSSGLAQW EGESSDPRLI       240
     VRGRANLLAH ELADLDRIRT LFDDLERKRD IAEFLELAEQ GEGVRIFIGS ENKLFSLSGS       300
     SLVVSPYMNA DRKIVGAVGV IGPTRLNYGR IVPIVDYTAQ LVGRLISGRK G                351
//

If you have problems or comments...

PBIL Back to PBIL home page