(data stored in ACNUC7421 zone)

EMBL: CP000489.PE90

CP000489.PE90        Location/Qualifiers
FT   CDS             82819..83619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0090"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eca:ECA3144 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68207"
FT                   /db_xref="GOA:A1AY63"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="UniProtKB/TrEMBL:A1AY63"
FT                   /protein_id="ABL68207.1"
FT                   /translation="MSITIITGDHPRHRYLADRLAEAGILTGWIIEQRKPFVPEVPAGL
FT                   PDDLGRLFALHFRRREEAEERFFGQPSLPDGLRMHYVTPDSLNEQASVDFLKTCAPRIV
FT                   LSYGCHKIADAVMAALPGTTFWNTHGGLSPQYRGVTTHFWPSYMLEPQMTGMTLHETTS
FT                   AIDGGAIIHQTVAPLDRNDGLHDIAGRTVKAYADELPPLLRTVLERDLPSGKVQKTSGK
FT                   IWTSADWRPDHLRLIYEVYNDRIAAAAVDGLIQGRTPICMSVLA"
     MSITIITGDH PRHRYLADRL AEAGILTGWI IEQRKPFVPE VPAGLPDDLG RLFALHFRRR        60
     EEAEERFFGQ PSLPDGLRMH YVTPDSLNEQ ASVDFLKTCA PRIVLSYGCH KIADAVMAAL       120
     PGTTFWNTHG GLSPQYRGVT THFWPSYMLE PQMTGMTLHE TTSAIDGGAI IHQTVAPLDR       180
     NDGLHDIAGR TVKAYADELP PLLRTVLERD LPSGKVQKTS GKIWTSADWR PDHLRLIYEV       240
     YNDRIAAAAV DGLIQGRTPI CMSVLA                                            266
//

If you have problems or comments...

PBIL Back to PBIL home page